DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxb1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001013266.2 Gene:Foxb1 / 367106 RGDID:1305217 Length:325 Species:Rattus norvegicus


Alignment Length:300 Identity:117/300 - (39%)
Similarity:153/300 - (51%) Gaps:67/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNL 65
            ||||.:.:|.||||||||||||||||..||:::|||||||:||||:||:||:|||:|||||||||
  Rat     1 MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNL 65

  Fly    66 SFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTE 130
            ||||||||:||...:.||||:|.|||...|||||||.|||||||:|  |:.|             
  Rat    66 SFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKV--LKSD------------- 115

  Fly   131 MVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMA 195
                       .:|.:.||.....|...:..::|       .|..:.|.||..|..|:.:..:..
  Rat   116 -----------HLAPSKPADAAQYLQQQAKLRLS-------ALAASGTHLPQMPAAAYNLGGVAQ 162

  Fly   196 PDPASTP--NEGLVPMEYGSPDAV---ALEKPP--FNLPFNFNELAAQYQLYFPSFFYNGQYGNI 253
            |.....|  .|.::..||..|..:   |::..|  :.||.....:.:.....:|..:  |..|.|
  Rat   163 PSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVY--GSAGMI 225

  Fly   254 PCYQKTP----------------PLFHNG-------PLPV 270
            .  ..||                ||.|..       |:|:
  Rat   226 D--SATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVPI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 66/87 (76%)
Alpha_kinase 106..>194 CDD:295997 18/87 (21%)
Foxb1NP_001013266.2 FH_FOXB2 1..110 CDD:410817 81/108 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1236900at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.