DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXI3

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001129121.1 Gene:FOXI3 / 344167 HGNCID:35123 Length:420 Species:Homo sapiens


Alignment Length:277 Identity:90/277 - (32%)
Similarity:122/277 - (44%) Gaps:41/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            :|||||.:|.||||..:|:|.|.||.||:|:.|.||||:::...||||:|||||.||||.||||:
Human   145 RPPYSYSALIAMAIQSAPERKLTLSHIYQFVADSFPFYQRSKAGWQNSIRHNLSLNDCFKKVPRD 209

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
            ....|||:||||.|....||:||:..|:|||      ..:.||.. ..||.|......|...|..
Human   210 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR------RSEASNGS-TVAAGTSKSEEGLSSGLGS 267

  Fly   143 MAFADP--------ARHGHV------LANASAAQMSPYKATPPILPTTVTQLPA-------RPKR 186
            .....|        .|..|.      ..:.:::...|...:.|.|.|..:.|.:       ..:|
Human   268 GVGGKPEEESPSTLLRPSHSPEPPEGTKSTASSPGGPMLTSTPCLNTFFSSLSSLSVSSSVSTQR 332

  Fly   187 AFTIESLMAPDPASTPNEGL---VPMEYGSPDAVALEKPPFNLPFNFNELAAQYQLYFPSFFYNG 248
            |......:....|..|:.|:   ..:...|.|.:.|.    |...|.....:.|...||:....|
Human   333 ALPGSRHLGIQGAQLPSSGVFSPTSISEASADTLQLS----NSTSNSTGQRSSYYSPFPASTSGG 393

  Fly   249 QYGNIPCYQKTPPLFHN 265
            |....    .:|  |||
Human   394 QSSPF----SSP--FHN 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 51/87 (59%)
Alpha_kinase 106..>194 CDD:295997 20/108 (19%)
FOXI3NP_001129121.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..122
Forkhead 145..231 CDD:278670 50/85 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..306 15/78 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..396 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.