DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and slp2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster


Alignment Length:243 Identity:82/243 - (33%)
Similarity:110/243 - (45%) Gaps:39/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSF 67
            :|:|...|::||||||.:|..|||..|.::.|.|:.||.:||...|:||.|.|.||||:|||||.
  Fly   170 KPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSL 234

  Fly    68 NDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMV 132
            |.||:||||:....|||:||.|.|.|.|:|..||..:.|:|              ..||:.:.:.
  Fly   235 NKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRR--------------TTAASRSRLA 285

  Fly   133 THYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQL-----PARPKRAFTIES 192
            ..       :.:...|...|    .|:..|...:...||..|:.:..:     |..||.......
  Fly   286 AF-------KRSLIGPMFPG----LAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPG 339

  Fly   193 LMAPDPASTPNEGLVPMEYGSPDAVALEKPPFNLPFNFNEL--AAQYQ 238
            |    |...|.....|...|.|..   ..|||..|...:||  ..|||
  Fly   340 L----PPGLPGLPGPPGPQGPPGP---PPPPFVAPPTSSELYQRLQYQ 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 48/87 (55%)
Alpha_kinase 106..>194 CDD:295997 14/92 (15%)
slp2NP_476834.1 Forkhead 180..265 CDD:306709 47/84 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445523
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.