DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxk2a

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001184186.1 Gene:foxk2a / 324141 ZFINID:ZDB-GENE-030131-2861 Length:544 Species:Danio rerio


Alignment Length:219 Identity:69/219 - (31%)
Similarity:98/219 - (44%) Gaps:42/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVP 75
            |.||||||..|...||..:|.:.|.|:.||..|...:|:||...:.||||:|||||.|..||||.
Zfish   202 DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVA 266

  Fly    76 RNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKR----FRVKQLEKDISNWKLAAAANTEMVTHYL 136
            |:..:.||||:|.:.|.:.....:.:..:||.|    ||..                       |
Zfish   267 RSQEEPGKGSFWRIDPSSEGKLMDQAFRKRRPRGVPCFRTP-----------------------L 308

  Fly   137 DDQLTQMAFADPARHGHVLANASAAQM--SPYKATP-PILPTTVTQLPARPKRAFTIESLMAPDP 198
            ....::.|.|.|...|.:.|::|..|.  |..:.:| |:.|........:||.|...||...   
Zfish   309 GPLSSRSAPASPTHTGVLSAHSSGVQTPDSSREGSPLPLEPEPSAAAAPQPKLAVIQESCFT--- 370

  Fly   199 ASTPNEGLVPMEYGSPDAVALEKP 222
            .:||         |||..:|:::|
Zfish   371 QNTP---------GSPVLIAVQQP 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 39/87 (45%)
Alpha_kinase 106..>194 CDD:295997 21/94 (22%)
foxk2aNP_001184186.1 FHA 16..105 CDD:238017
Forkhead 204..290 CDD:278670 39/85 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.