DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXA2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_068556.2 Gene:FOXA2 / 3170 HGNCID:5022 Length:463 Species:Homo sapiens


Alignment Length:294 Identity:110/294 - (37%)
Similarity:154/294 - (52%) Gaps:48/294 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLS 66
            |:..:.||...|||||||||..|||..||.::|.|||||::|||.|||||:|.|:||||:||:||
Human   154 PKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLS 218

  Fly    67 FNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEM 131
            |||||:||||:..|.||||:|||||.:.:|||||..|||:|||:   .||.::..:.|.||.:  
Human   219 FNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK---CEKQLALKEAAGAAGS-- 278

  Fly   132 VTHYLDDQLTQMAFADPARHGHVLANAS---AAQMSPYKATPPILPTT---VTQLPARPKRAFTI 190
                 ..:....|.|..|:.|.....||   |...||:.:..|.....   :.:|...|..|   
Human   279 -----GKKAAAGAQASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAA--- 335

  Fly   191 ESLMAPDPASTPNE---------------GLVPMEYGSPDAVALEKPPFNLPFNFNELAAQYQLY 240
              |..|:||.:|.:               ||.|..:..|:    ....||.||:.|.|.:..|.:
Human   336 --LSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPE----HHYAFNHPFSINNLMSSEQQH 394

  Fly   241 FPSFFYNGQYG-NIPCYQKTPPLFH----NGPLP 269
            ..|..::..:. ::..|::   :.|    ..|:|
Human   395 HHSHHHHQPHKMDLKAYEQ---VMHYPGYGSPMP 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 61/87 (70%)
Alpha_kinase 106..>194 CDD:295997 21/93 (23%)
FOXA2NP_068556.2 Forkhead_N 23..164 CDD:369872 3/9 (33%)
FH_FOXA2 163..264 CDD:410813 68/103 (66%)
HNF_C 380..452 CDD:401339 10/49 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.