DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXA1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_004487.2 Gene:FOXA1 / 3169 HGNCID:5021 Length:472 Species:Homo sapiens


Alignment Length:302 Identity:113/302 - (37%)
Similarity:149/302 - (49%) Gaps:70/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSF 67
            :..|.||...|||||||||..|||..:|.::|.|||||::|||.||:||:|.|:||||:||:|||
Human   160 KTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSF 224

  Fly    68 NDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVK-------------------- 112
            ||||:||.|:..|.||||||||||.:.:|||||..|||:|||:.:                    
Human   225 NDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKG 289

  Fly   113 --QLEKDISNWKLAAAANTEMVT------HYLDDQLTQMAFADPAR------HGHVLANASAAQM 163
              :..||.|     .|:|....:      |....||.......||.      |....|...|:::
Human   290 GPESRKDPS-----GASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASEL 349

  Fly   164 -SPYKAT-PPILPTTVTQLPARPKRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALEKPP--- 223
             :|..:| |||        .:.|       ..:|..|||.|..||.|.|    ..:.|:..|   
Human   350 KTPASSTAPPI--------SSGP-------GALASVPASHPAHGLAPHE----SQLHLKGDPHYS 395

  Fly   224 FNLPFNFNELAA----QYQLYFPSFFYNGQYGNIPCYQKTPP 261
            ||.||:.|.|.:    |::|.|.::....||..   |..|.|
Human   396 FNHPFSINNLMSSSEQQHKLDFKAYEQALQYSP---YGSTLP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 59/87 (68%)
Alpha_kinase 106..>194 CDD:295997 22/123 (18%)
FOXA1NP_004487.2 Forkhead_N 17..169 CDD:369872 3/8 (38%)
FH_FOXA1 157..268 CDD:410812 69/107 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..392 29/146 (20%)
HNF_C 398..461 CDD:401339 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.