DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxd2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_233422.5 Gene:Foxd2 / 313504 RGDID:1304642 Length:494 Species:Rattus norvegicus


Alignment Length:246 Identity:93/246 - (37%)
Similarity:116/246 - (47%) Gaps:56/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.||::.|.||||..||..:||:||:....||||:|||||.||||:|:||.
  Rat   131 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 195

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQL---------EKDISNWKLAAAANTEMVT 133
            ....|||:||||.|.:.|||:|||.|||||||:.:.|         ..::.....||||.     
  Rat   196 PGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLPPPHPHPHPHPELLLRGGAAAAG----- 255

  Fly   134 HYLDDQLTQMAFA-------------------------DPARHGHVLANASAA--QMS--PYKAT 169
               |.......||                         .|..|.|..|.|:.|  |:|  |.:|.
  Rat   256 ---DPGAFLSGFAAYGAYGYGYGLALPAYGAPPPGPAPHPHPHPHAFAFAATAPCQLSVPPGRAA 317

  Fly   170 PPILPTTVTQLPARPKRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALE 220
            .|  |      |..|..:....:..||.||..|..|  |...|.|..:..|
  Rat   318 AP--P------PGPPTASVFASATSAPAPAPAPGSG--PSPAGLPAFLGAE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 52/87 (60%)
Alpha_kinase 106..>194 CDD:295997 26/125 (21%)
Foxd2XP_233422.5 FH_FOXD1_D2-like 131..229 CDD:410820 61/97 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.