DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxs1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001012091.1 Gene:Foxs1 / 311547 RGDID:1310679 Length:327 Species:Rattus norvegicus


Alignment Length:345 Identity:109/345 - (31%)
Similarity:133/345 - (38%) Gaps:132/345 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|.||||..||.:...||.|||:||.:|.|||.|...||||:|||||.|:||:||||:
  Rat    18 KPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRD 82

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
            ..|.||||||||.|...|||::||.||||:||.           |...|..|:            
  Rat    83 DRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRFT-----------KRTGAQGTK------------ 124

  Fly   143 MAFADPARHGH-VLANASAAQMSPYKAT------PPILPT---------------------TVTQ 179
                .|.:..| .|...|..|.:|...|      ||.:|.                     |..|
  Rat   125 ----GPVKADHRPLRATSPDQGAPNTTTGRLCPFPPEVPNPKGFGGLMGSLPANMCPTTSDTRPQ 185

  Fly   180 LPARPK----------------------------RAFT-IESL-MAPDPASTPNE---------- 204
            ||..||                            .||: .||| .||.|:..|..          
  Rat   186 LPTGPKDMCSAKSGGPRELSEATSPSPCPAFGFSSAFSEAESLGKAPTPSVAPESIGSSYQCRMQ 250

  Fly   205 ------GLVP-MEY---------GSPDAVALEKPPFNLPFNFNEL----------AAQYQLYFPS 243
                  |..| :|:         ||....|..:.|..||.:..|.          .:.|.|..| 
  Rat   251 TLNFCMGADPGLEHLLTSAVATPGSSTPSASHRAPLPLPADSKEPWVPGGFPVQGGSGYPLGLP- 314

  Fly   244 FFYNGQYGNIPCYQKTPPLF 263
                      ||..:||.:|
  Rat   315 ----------PCLYRTPGMF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 55/87 (63%)
Alpha_kinase 106..>194 CDD:295997 27/145 (19%)
Foxs1NP_001012091.1 Forkhead 18..103 CDD:278670 54/84 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.