DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxa3

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_571374.1 Gene:foxa3 / 30559 ZFINID:ZDB-GENE-980526-423 Length:441 Species:Danio rerio


Alignment Length:263 Identity:96/263 - (36%)
Similarity:145/263 - (55%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNL 65
            ||:|.:.|....|||||||||..|||..|..::|.|:|||::|||.||:||:|.|:||||:||:|
Zfish   131 MPKPYRRSLTHAKPPYSYISLITMAIQQSQSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSL 195

  Fly    66 SFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTE 130
            ||||||:||.|:..|.||||||.|||.:.:|||||..|||:|||::::.....|:.|....::|:
Zfish   196 SFNDCFVKVARSPDKPGKGSYWALHPNSGNMFENGCYLRRQKRFKIEEKAGKKSSSKSQDGSSTK 260

  Fly   131 MVTHY---LDDQLTQMAFADPARHGHVLAN----------ASAAQMSPYKATPPILPTTVTQLPA 182
             .||.   :.::.:....:|.|...|..::          .|..|:......|.:|.::...:|:
Zfish   261 -GTHSSEGMQEEHSPTTGSDGAESAHSDSSHAGSTSEEQQRSLVQLDCPSQAPNLLHSSPVPIPS 324

  Fly   183 RPKRAFTIESLMAPDPASTPNEGL--VPMEYGSP-DAVALEKPP---------FNLPFNFNELAA 235
                  ::.:.|.|..:...::|:  .|...||| ..:.|:..|         ||.||:...|.:
Zfish   325 ------SVSASMPPSSSHLHSQGMGNSPHLLGSPMHHLDLQNDPLKSMDPHFNFNHPFSITNLMS 383

  Fly   236 QYQ 238
            ..|
Zfish   384 NEQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 57/87 (66%)
Alpha_kinase 106..>194 CDD:295997 16/100 (16%)
foxa3NP_571374.1 Forkhead_N 17..142 CDD:254796 4/10 (40%)
FH 143..231 CDD:214627 57/87 (66%)
HNF_C 374..>408 CDD:286443 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.