DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxd2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_571346.2 Gene:foxd2 / 30525 ZFINID:ZDB-GENE-980605-6 Length:369 Species:Danio rerio


Alignment Length:245 Identity:91/245 - (37%)
Similarity:124/245 - (50%) Gaps:41/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.||::.|.||||..||.::||:||:....||||:|||||.||||:|:||.
Zfish    95 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 159

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDIS----------------NWKLAAA 126
            ....|||:||||.|.:.|||:|||.|||||||:..|..:.:.                |:.|...
Zfish   160 PGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRHQTNEILREAGGFLPGFGYGPYGYNYGLQLQ 224

  Fly   127 ---ANTEMVTHY----LDDQLTQMAFADPAR-----H------GHVLANASAAQMSPYKATPPIL 173
               |:.....|:    ...|.|..|...|:.     |      |..|......|:||  ..|.:.
Zfish   225 NFHAHHPYHPHHPGSAFPFQNTHCALPTPSSIFSTPHSLPSFLGTELRKPFYPQLSP--TLPGLA 287

  Fly   174 P-TTVTQLPARPKRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALEKP 222
            | .|.|..|:||  :|:|::::.  .||:|.........|....:|:..|
Zfish   288 PLKTDTNGPSRP--SFSIDNIIG--AASSPASPYTTQPAGQAQILAMLTP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 52/87 (60%)
Alpha_kinase 106..>194 CDD:295997 28/122 (23%)
foxd2NP_571346.2 Forkhead 95..181 CDD:278670 51/85 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.