DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxd5

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_571345.1 Gene:foxd5 / 30524 ZFINID:ZDB-GENE-980605-4 Length:321 Species:Danio rerio


Alignment Length:260 Identity:92/260 - (35%)
Similarity:129/260 - (49%) Gaps:68/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.||.:.|.||.|..||.::||:|::....||||:|||||.||||||:||.
Zfish    73 KPPYSYIALITMAILQSPMKKLTLSGICDFISNKFPYYKEKFPAWQNSIRHNLSLNDCFIKIPRE 137

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLE--KDISNWKLAAAANTEMVTHYLDDQL 140
            ....|||:||:|.|.:.|||:|||.|||||||:..|.|  ||            .:|.::  ..|
Zfish   138 PGNPGKGNYWSLDPASEDMFDNGSFLRRRKRFKRNQPEFTKD------------SLVLYH--PTL 188

  Fly   141 TQMAFADPARHGHVLANASAAQMSP--YKATPP--ILPTTVTQ-------------LPARPKR-- 186
            :..|:..|    :.::.|..||.:|  |...|.  ::|....|             :..||:.  
Zfish   189 SYRAYGRP----YCVSGAVPAQTNPVGYLPVPDGIMVPPPFFQYQTMNIKIHDAPEIQQRPEHKT 249

  Fly   187 ---AFTIESLMAPDPAS---------TPN--------------EGLVPMEYGSPDAVALEKPPFN 225
               :|:|:|:||....|         ||:              ..|||:...:|   .|:..||:
Zfish   250 QRCSFSIDSIMAKSTESSSKSSAHHLTPDYSFVFPRPTTSCVAPSLVPVPTRTP---LLKTVPFS 311

  Fly   226  225
            Zfish   312  311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 50/87 (57%)
Alpha_kinase 106..>194 CDD:295997 25/111 (23%)
foxd5NP_571345.1 Forkhead 73..159 CDD:278670 49/85 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.