DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxg1a

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_571142.1 Gene:foxg1a / 30274 ZFINID:ZDB-GENE-990415-267 Length:420 Species:Danio rerio


Alignment Length:259 Identity:85/259 - (32%)
Similarity:116/259 - (44%) Gaps:47/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            :|||:||.:|..|||..||::.|.|:.||.|||..||:||:|.|.||||:|||||.|.||:||||
Zfish   112 EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPR 176

  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLT 141
            :....|||:||.|.|.:.|:|..|:..:.|:|       ...|..|||......:.:       |
Zfish   177 HYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRR-------STTSRAKLAFKRGARLTS-------T 227

  Fly   142 QMAFADPA----------------RHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTI 190
            .:.|.|.|                |....|:...|:  |.|.:.|....|.:||.......:|..
Zfish   228 GLTFMDRAGSLYWPMSPFLSLHHPRASSALSYNGAS--SAYPSHPMSYSTMLTQNSLGNNHSFPA 290

  Fly   191 ESLMAPDPASTPNEGLVPMEYGSPDAVAL-EKPPFNL-----------PFNFNELAAQYQLYFP 242
            .:.::.|...   .|.:|.......|.|| ...|..|           |.:.|.||.|...:||
Zfish   291 SNGLSVDRLV---NGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFP 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 49/87 (56%)
Alpha_kinase 106..>194 CDD:295997 20/103 (19%)
foxg1aNP_571142.1 FH 113..201 CDD:214627 49/87 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.