DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxd3

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_008762182.2 Gene:Foxd3 / 29203 RGDID:621715 Length:469 Species:Rattus norvegicus


Alignment Length:200 Identity:88/200 - (44%)
Similarity:114/200 - (56%) Gaps:18/200 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.|||:.|.||.|..||.::||:||:....||||:|||||.||||:|:||.
  Rat   131 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 195

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLE----------KDISNWKLAAAANTEMV 132
            ....|||:||||.|.:.|||:|||.|||||||:..|.|          :....:.|||||:....
  Rat   196 PGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEHLREQTALMMQSFGAYSLAAAASAGPY 260

  Fly   133 --THYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATP--PILPTTVTQLPARP--KRAFTIE 191
              .:.|.......|::.||  ....|.|:||...||...|  |:||..|..||:..  ::|....
  Rat   261 GRPYGLHPAAAAGAYSHPA--AAAAAAAAAALQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFG 323

  Fly   192 SLMAP 196
            |.:.|
  Rat   324 SQLGP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 52/87 (60%)
Alpha_kinase 106..>194 CDD:295997 30/103 (29%)
Foxd3XP_008762182.2 FH_FOXD3 130..226 CDD:410821 58/94 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.