DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxi1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001099246.1 Gene:Foxi1 / 287185 RGDID:1307421 Length:372 Species:Rattus norvegicus


Alignment Length:280 Identity:91/280 - (32%)
Similarity:123/280 - (43%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            :|||||.:|.||||..:|.:.|.||:||:::.|.||||.|:...||||:|||||.||||.||||:
  Rat   117 RPPYSYSALIAMAIHGAPDQRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRD 181

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
            ....|||:||||.|....||:||:..|:|||             |..|:::|..:.....:....
  Rat   182 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR-------------KSDASSSTGSLASEKTENRLL 233

  Fly   143 MAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPASTP----- 202
            .:...|.....||..||              |.|.:..|         |...:|.|:.||     
  Rat   234 SSSPKPTEPQEVLDTAS--------------PDTTSSSP---------EKRSSPAPSGTPCLNNF 275

  Fly   203 -------NEGLVPMEYG------SPDAVALEKPPFNLPFNFNELAAQYQLYFP-----SFFYNGQ 249
                   ..|..|:...      ||:.|  :|...| ..|||.       |.|     |....|:
  Rat   276 LSTMTAYVNGTNPISRSAATPGLSPEPV--DKMGQN-SLNFNS-------YTPLTNLSSHGNGGE 330

  Fly   250 YGN-IPCYQKTPPLFHNGPL 268
            :.| :|    |..|.:.||:
  Rat   331 WANPVP----TNALGYGGPV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 50/87 (57%)
Alpha_kinase 106..>194 CDD:295997 15/87 (17%)
Foxi1NP_001099246.1 FH 117..205 CDD:214627 50/87 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.