DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXD4L3

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_954586.4 Gene:FOXD4L3 / 286380 HGNCID:18523 Length:417 Species:Homo sapiens


Alignment Length:235 Identity:84/235 - (35%)
Similarity:107/235 - (45%) Gaps:69/235 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.:|.:.|.||.|..||..:||:||:....||||:|||||.||||:|:||.
Human   108 KPPYSYIALITMAILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPRE 172

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
            ....|||:||:|.|.:.|||:|||.|||||||:..||.....            :.|        
Human   173 PGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAH------------LPH-------- 217

  Fly   143 MAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPASTPNEG-- 205
             .|..||.|        ||..:|       .|..:...||.|:          |.|.:.||..  
Human   218 -PFPLPAAH--------AALHNP-------RPGPLLGAPAPPQ----------PVPGAYPNTAPG 256

  Fly   206 -----------------LVPMEYGSP---DAVALEKP-PF 224
                             ..|:..|:|   :..||..| ||
Human   257 RRPYALLHPHPLRYLLLSAPVYAGAPKKAEGAALATPAPF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 49/87 (56%)
Alpha_kinase 106..>194 CDD:295997 18/87 (21%)
FOXD4L3NP_954586.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..105
Forkhead 108..194 CDD:278670 48/85 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.