DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXB1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036314.2 Gene:FOXB1 / 27023 HGNCID:3799 Length:325 Species:Homo sapiens


Alignment Length:300 Identity:117/300 - (39%)
Similarity:153/300 - (51%) Gaps:67/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNL 65
            ||||.:.:|.||||||||||||||||..||:::|||||||:||||:||:||:|||:|||||||||
Human     1 MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNL 65

  Fly    66 SFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTE 130
            ||||||||:||...:.||||:|.|||...|||||||.|||||||:|  |:.|             
Human    66 SFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKV--LKSD------------- 115

  Fly   131 MVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMA 195
                       .:|.:.||.....|...:..::|       .|..:.|.||..|..|:.:..:..
Human   116 -----------HLAPSKPADAAQYLQQQAKLRLS-------ALAASGTHLPQMPAAAYNLGGVAQ 162

  Fly   196 PDPASTP--NEGLVPMEYGSPDAV---ALEKPP--FNLPFNFNELAAQYQLYFPSFFYNGQYGNI 253
            |.....|  .|.::..||..|..:   |::..|  :.||.....:.:.....:|..:  |..|.|
Human   163 PSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVY--GSAGMI 225

  Fly   254 PCYQKTP----------------PLFHNG-------PLPV 270
            .  ..||                ||.|..       |:|:
Human   226 D--SATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVPI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 66/87 (76%)
Alpha_kinase 106..>194 CDD:295997 18/87 (21%)
FOXB1NP_036314.2 FH_FOXB2 1..110 CDD:410817 81/108 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG3562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3922
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1236900at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - mtm8587
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.