DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXD3

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036315.1 Gene:FOXD3 / 27022 HGNCID:3804 Length:478 Species:Homo sapiens


Alignment Length:252 Identity:96/252 - (38%)
Similarity:125/252 - (49%) Gaps:50/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.|||:.|.||.|..||.::||:||:....||||:|||||.||||:|:||.
Human   141 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 205

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLE----------KDISNWKLAAAANTEMV 132
            ....|||:||||.|.:.|||:|||.|||||||:..|.|          :....:.|||||.....
Human   206 PGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEHLREQTALMMQSFGAYSLAAAAGAAGP 270

  Fly   133 ---THYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATP--PILPTTVTQLPA----RPKRAF 188
               .:.|.......|::.||  ....|.|:||...||...|  |:||..|..||:    |...||
Human   271 YGRPYGLHPAAAAGAYSHPA--AAAAAAAAAALQYPYALPPVAPVLPPAVPLLPSGELGRKAAAF 333

  Fly   189 -----------------------------TIESLMAPDPASTPNEGLVPMEYGSPDA 216
                                         |..||:..:|::.|:..:..:..|.|.|
Human   334 GSQLGPGLQLQLNSLGAAAAAAGTAGAAGTTASLIKSEPSARPSFSIENIIGGGPAA 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 52/87 (60%)
Alpha_kinase 106..>194 CDD:295997 33/135 (24%)
FOXD3NP_036315.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..136
Forkhead 141..227 CDD:278670 51/85 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.