Sequence 1: | NP_524496.1 | Gene: | fd96Cb / 43011 | FlyBaseID: | FBgn0004898 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_594272.1 | Gene: | fhl1 / 2541552 | PomBaseID: | SPAC1142.08 | Length: | 743 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 302 | Identity: | 76/302 - (25%) |
---|---|---|---|
Similarity: | 117/302 - (38%) | Gaps: | 92/302 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 GD--QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFI 72
Fly 73 KVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKR----------------------------- 108
Fly 109 FRVKQL--EKDISNWKLAAA------------------------------------ANTE----- 130
Fly 131 --------MVTHYLDDQLTQMAFADPARHGHVLANASA---AQMSPYKATPPILPTTVTQLPARP 184
Fly 185 KRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALEKPPFNL 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd96Cb | NP_524496.1 | FH | 13..101 | CDD:214627 | 36/87 (41%) |
Alpha_kinase | 106..>194 | CDD:295997 | 26/170 (15%) | ||
fhl1 | NP_594272.1 | COG5025 | 1..564 | CDD:227358 | 72/281 (26%) |
FHA | <38..119 | CDD:238017 | |||
Forkhead | 291..376 | CDD:278670 | 34/84 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2114 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |