DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and fhl1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_594272.1 Gene:fhl1 / 2541552 PomBaseID:SPAC1142.08 Length:743 Species:Schizosaccharomyces pombe


Alignment Length:302 Identity:76/302 - (25%)
Similarity:117/302 - (38%) Gaps:92/302 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GD--QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFI 72
            ||  |||..||.:|.|..:|.:|.:.:.|.:|..:|.:.:.:||.....|.||:|||||.|..||
pombe   286 GDATQKPNLSYANLIARTLIANPNKKMTLGDICEWIANNWSYYRHQPPAWHNSIRHNLSLNKAFI 350

  Fly    73 KVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKR----------------------------- 108
            ::||...:.||||:|.|.|...|.|| |:..||.|:                             
pombe   351 RIPRRQNEPGKGSFWMLDPSYIDQFE-GNFFRRTKKPTPSATPAAHPDTARENELAAIQTKGISA 414

  Fly   109 FRVKQL--EKDISNWKLAAA------------------------------------ANTE----- 130
            .:.:||  :|:.|..|...:                                    ||.|     
pombe   415 GKTEQLNPQKETSRSKTHTSRGENVEDRPQSLLQNGIQPIIMRDGKLALNPEFFKNANGEQQAPN 479

  Fly   131 --------MVTHYLDDQLTQMAFADPARHGHVLANASA---AQMSPYKATPPILPTTVTQLPARP 184
                    ::..:::.||...|..:| .....:|||.|   ||....:.|....|..|.| .|:.
pombe   480 EQAVQAISLLQQHINKQLGPAAANNP-EQATAIANALAVALAQKLQKQQTQMQGPQQVQQ-QAKR 542

  Fly   185 KRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALEKPPFNL 226
            ::|:|.:.| .|.|.:.|:..:..   .||.....::|..|:
pombe   543 RKAYTSQQL-NPAPTAMPHPNITS---PSPSISVTQRPAVNV 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 36/87 (41%)
Alpha_kinase 106..>194 CDD:295997 26/170 (15%)
fhl1NP_594272.1 COG5025 1..564 CDD:227358 72/281 (26%)
FHA <38..119 CDD:238017
Forkhead 291..376 CDD:278670 34/84 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.