DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and mei4

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_595617.1 Gene:mei4 / 2540241 PomBaseID:SPBC32H8.11 Length:517 Species:Schizosaccharomyces pombe


Alignment Length:343 Identity:79/343 - (23%)
Similarity:126/343 - (36%) Gaps:116/343 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMSYGD---------QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSL 61
            :|.:||         :|||.||.:|..:||:.|..:.|.||.||.:|.:.|.:|..:...||||:
pombe    65 QMIFGDEMAGFVDTGEKPPCSYATLIGLAILQSHNKQLTLSGIYTWIRNTFRYYLNHDGGWQNSI 129

  Fly    62 RHNLSFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLR---------------------- 104
            |||||.|..||||.:...|..||.|||:.|.....|.:..|.|                      
pombe   130 RHNLSLNKAFIKVEKPKGKTLKGHYWTIDPDHMQNFVSVRLHRSHSTDSNSKKRPSSKCHEIKPL 194

  Fly   105 -------RRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQMAFADPARHGHVLANASAAQ 162
                   .|||.|:...     |...:.:.::..|...:.:..:|.:..|.:.:.:::       
pombe   195 TTREIPLARKRSRLNSF-----NSSTSTSGSSSNVAAEVSNDASQPSNQDSSLNSNIV------- 247

  Fly   163 MSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPASTPNEGL--------------------- 206
                  .||:.|:.|        ::.:..|...|.|.:...|.|                     
pombe   248 ------KPPLPPSNV--------QSNSSSSENVPKPNAETQEDLPTIDAHESSLYENVNDSRLYE 298

  Fly   207 VP------MEYGSPDAVALEKPPF-----------NLPFNFNE---------LAAQYQLYFPSFF 245
            ||      :..|..||    .|.:           :||::.||         |.:|......|:.
pombe   299 VPACRNMALNTGYSDA----DPGYLRTSFRSNSHNSLPYSANEEEDVLQADFLVSQQSSMVSSYV 359

  Fly   246 YNGQYGNIPCYQKTP-PL 262
            .:....::|.|::.| ||
pombe   360 SSRDPHSMPYYRREPIPL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 39/87 (45%)
Alpha_kinase 106..>194 CDD:295997 13/87 (15%)
mei4NP_595617.1 COG5025 1..517 CDD:227358 79/343 (23%)
Forkhead 81..167 CDD:278670 39/85 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.