DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxd4

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_001055972.2 Gene:Foxd4 / 252886 RGDID:621716 Length:432 Species:Rattus norvegicus


Alignment Length:317 Identity:103/317 - (32%)
Similarity:137/317 - (43%) Gaps:101/317 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLS 66
            |:|       .|||||||:|..|||:.||.:.|.||.|..||..:||:||:....||||:|||||
  Rat    99 PQP-------AKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLS 156

  Fly    67 FNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFR--------------------- 110
            .||||:|:||.....|||:||:|.|.:.|||:|||.|||||||:                     
  Rat   157 LNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHHPPPGGHPHCPFPPPAVPA 221

  Fly   111 VKQLEKDISNWKLAAAANTEMVTH-------------------YLDDQLTQMAFADPARHGHVLA 156
            ..|:.:.....:.:|.....:..|                   ||  .|...|:||..|      
  Rat   222 TVQVSQPGLLLRYSAPPQPNLAVHPASPPRSRPCAPLHPYPLRYL--LLAAPAYADEPR------ 278

  Fly   157 NASAAQMSPYKATPPILPTTVTQLP--------ARPKR---AFTIESLMAPDPASTPNEGLVPME 210
            .|..|..:...|.|.:.|...:| |        :|.:|   :|||||:|         :|:....
  Rat   279 KAEGADPATSLAIPALQPAPGSQ-PWEGDQGSGSRSRRGCASFTIESIM---------QGVTGGG 333

  Fly   211 YGSPDAVALEKPPFNLPFNFNELAAQYQLYFPSFFYNGQYGNIPCY---QKTPPLFH 264
            .||     .:.||| .|:::..|     |..|           ||.   |...||||
  Rat   334 TGS-----AQSPPF-APWSYCHL-----LQHP-----------PCLLHPQAASPLFH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 50/87 (57%)
Alpha_kinase 106..>194 CDD:295997 28/138 (20%)
Foxd4XP_001055972.2 Forkhead 103..189 CDD:278670 49/85 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.