DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxa2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006235201.1 Gene:Foxa2 / 25099 RGDID:2808 Length:465 Species:Rattus norvegicus


Alignment Length:286 Identity:110/286 - (38%)
Similarity:156/286 - (54%) Gaps:30/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLS 66
            |:..:.||...|||||||||..|||..||.::|.|||||::|||.|||||:|.|:||||:||:||
  Rat   154 PKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLS 218

  Fly    67 FNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEM 131
            |||||:||||:..|.||||:|||||.:.:|||||..|||:|||:   .||.::..:.|.|.:...
  Rat   219 FNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK---CEKQLALKEAAGAGSGGG 280

  Fly   132 VTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTT---VTQLPARPKRAFTIESL 193
            .......|.:|:...:.|...   :...|...||:.:..|.....   :::|...|..|     |
  Rat   281 KKTAPGTQASQVQLGEAAGSA---SETPAGTESPHSSASPCQEHKRGGLSELKGTPASA-----L 337

  Fly   194 MAPDPASTPNEG-------LVPMEY-GSPDAVALEKP----PFNLPFNFNELAAQYQLYFPSFFY 246
            ..|:||.:|.:.       |||..: |.|....| ||    .||.||:.|.|.:..|.:..|..:
  Rat   338 SPPEPAPSPGQQQQAAAHLLVPPHHPGLPPEAHL-KPEHHYAFNHPFSINNLMSSEQQHHHSHHH 401

  Fly   247 NGQYG-NIPCYQKTP--PLFHNGPLP 269
            :..:. ::..|::..  |..:..|:|
  Rat   402 HQPHKMDLKTYEQVMHYPGGYGSPMP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 61/87 (70%)
Alpha_kinase 106..>194 CDD:295997 17/90 (19%)
Foxa2XP_006235201.1 Forkhead_N 23..164 CDD:254796 3/9 (33%)
FH 165..253 CDD:214627 61/87 (70%)
HNF_C 381..454 CDD:286443 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.