DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxi2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_341950.2 Gene:Foxi2 / 246073 RGDID:621739 Length:337 Species:Rattus norvegicus


Alignment Length:216 Identity:76/216 - (35%)
Similarity:104/216 - (48%) Gaps:49/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            :|||||.:|.||||..:|.|.|.||:||:::...||||:::...||||:|||||.||||.||||:
  Rat   125 RPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRD 189

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
            ....|||:||||.|....||:||:..|:|:|      ..:.|...:..|:..|            
  Rat   190 ENDPGKGNYWTLDPNCEKMFDNGNFRRKRRR------RGETSEAAVPGASRPE------------ 236

  Fly   143 MAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPA-----STP 202
            .|..:|:  |.|   :...|.||              .|..|:.|..:.|......|     ||.
  Rat   237 RAALEPS--GLV---SQDLQTSP--------------SPTAPEAAACLSSFSTALGALAGGFSTL 282

  Fly   203 NEGLVPMEYGSPDAVALEKPP 223
            .:||       |...:|.:||
  Rat   283 PDGL-------PQDFSLRRPP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 49/87 (56%)
Alpha_kinase 106..>194 CDD:295997 16/87 (18%)
Foxi2XP_341950.2 Forkhead 125..211 CDD:278670 48/85 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.