DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXS1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_004109.1 Gene:FOXS1 / 2307 HGNCID:3735 Length:330 Species:Homo sapiens


Alignment Length:277 Identity:99/277 - (35%)
Similarity:126/277 - (45%) Gaps:65/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNL 65
            :|.|...:....|||||||:|.||||..||.:...||.|||:||.:|.|||.|...||||:||||
Human     6 LPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNL 70

  Fly    66 SFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTE 130
            |.|:||:||||:..|.||||||||.|...||||:||.||||:||                     
Human    71 SLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRF--------------------- 114

  Fly   131 MVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKAT--PPILPTTVT--------QLPARPK 185
                      |:...|:..|      ..:.|:..|.:||  .|.:|...|        :|| .||
Human   115 ----------TRQTGAEGTR------GPAKARRGPLRATSQDPGVPNATTGRQCSFPPELP-DPK 162

  Fly   186 RAFTIESLMAPDPAS-----TPNEGLVPMEYGSPDAVALEKP--PFNLPFNFNELAAQYQLYFPS 243
             ..:...|:...|||     |......|||   |..::..||  |..||      .|......|:
Human   163 -GLSFGGLVGAMPASMCPATTDGRPRPPME---PKEISTPKPACPGELP------VATSSSSCPA 217

  Fly   244 FFYNGQYGNIPCYQKTP 260
            |.:...:.....:.|.|
Human   218 FGFPAGFSEAESFNKAP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 56/87 (64%)
Alpha_kinase 106..>194 CDD:295997 17/97 (18%)
FOXS1NP_004109.1 Forkhead 18..103 CDD:306709 54/84 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..157 13/82 (16%)
DNA_pol3_gamma3 <116..313 CDD:331207 32/136 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..200 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.