DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXJ1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001445.2 Gene:FOXJ1 / 2302 HGNCID:3816 Length:421 Species:Homo sapiens


Alignment Length:286 Identity:76/286 - (26%)
Similarity:112/286 - (39%) Gaps:81/286 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPLKMSYGDQ---KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRH 63
            |.|..:.|...   ||||||.:|..||:..|....:.||.||::|.|.|.::|.....||||:||
Human   107 PPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRH 171

  Fly    64 NLSFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAAN 128
            |||.|.|||||||...:.|||.:|.:.|...:...:|:..:||                      
Human   172 NLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRR---------------------- 214

  Fly   129 TEMVTHYLDDQLTQMAFADPA---RHGHVLANASAAQM-------------------SPYKATPP 171
              :...::.....:.|..:|:   |.|.:..|..|.|:                   ..:|...|
Human   215 --LPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQP 277

  Fly   172 ILPTTVTQLPARPKRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALEKPPFNLPFNFNELAAQ 236
             ||..|.::|..|       |.:.|          .|.|.|       |..|  |..||:     
Human   278 -LPKRVAKVPRPP-------STLLP----------TPEEQG-------ELEP--LKGNFD----- 310

  Fly   237 YQLYFPSFFYNGQYGNIPCYQKTPPL 262
            ::..|.:....|:.|.:...:.:|||
Human   311 WEAIFDAGTLGGELGALEALELSPPL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 40/87 (46%)
Alpha_kinase 106..>194 CDD:295997 16/109 (15%)
FOXJ1NP_001445.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..116 3/8 (38%)
Forkhead 121..205 CDD:306709 40/83 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..302 12/65 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.