DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXL1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_005241.1 Gene:FOXL1 / 2300 HGNCID:3817 Length:345 Species:Homo sapiens


Alignment Length:288 Identity:96/288 - (33%)
Similarity:134/288 - (46%) Gaps:58/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            ||||||||:|.||||..:|::.:.|:.||:||||:||||..|.|.||||:|||||.||||:||||
Human    48 QKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPR 112

  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRR------------KRFRVKQLEKD------------ 117
            ...:.||||||||.|...||||||:..||:            ||.|.:..::.            
Human   113 EKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAG 177

  Fly   118 -----ISNWKLAAAANTEMV--------THYLDDQLTQMAFADPARHGHVLANASAAQMSPYKAT 169
                 ||..:.|.|..:.::        .|:...........|.|:....:|...||:......:
Human   178 GSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAARTGDGPGS 242

  Fly   170 PPILPTTVTQLPARPK-RAFTIESLMAPDPASTPNE------GLVPMEYGSPDAVALE-----KP 222
             |:.|.:.:...:..| ::|:|:|::|......|..      |..|...|...|..|.     :|
Human   243 -PLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSGDELLGGAKPGPGGRLGASLLAASSSLRP 306

  Fly   223 PFNLPF--------NFNELAAQYQLYFP 242
            |||...        .|.:|...:..|||
Human   307 PFNASLMLDPHVQGGFYQLGIPFLSYFP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 57/87 (66%)
Alpha_kinase 106..>194 CDD:295997 19/125 (15%)
FOXL1NP_005241.1 FH 49..137 CDD:214627 57/87 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..289 26/153 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.