DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXI1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036320.2 Gene:FOXI1 / 2299 HGNCID:3815 Length:378 Species:Homo sapiens


Alignment Length:238 Identity:85/238 - (35%)
Similarity:113/238 - (47%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            :|||||.:|.||||..:|.:.|.||:||:::.|.||||.|:...||||:|||||.||||.||||:
Human   123 RPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRD 187

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
            ....|||:||||.|....||:||:..|:|||      :.|:|:...:.|......:..:|...| 
Human   188 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR------KSDVSSSTASLALEKTESSLPVDSPKT- 245

  Fly   143 MAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPASTP--NEG 205
               .:|.   .:|..||              |...|..|         |...:|.|:..|  |..
Human   246 ---TEPQ---DILDGAS--------------PGGTTSSP---------EKRPSPPPSGAPCLNSF 281

  Fly   206 LVPM----EYGSPDAVALEKPPFNLPFNFNELAAQYQLYFPSF 244
            |..|    ..|||.:..|..|  .|....::...|..|.|.||
Human   282 LSSMTAYVSGGSPTSHPLVTP--GLSPEPSDKTGQNSLTFNSF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 50/87 (57%)
Alpha_kinase 106..>194 CDD:295997 16/87 (18%)
FOXI1NP_036320.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
FH 123..211 CDD:214627 50/87 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..278 22/105 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.