Sequence 1: | NP_524496.1 | Gene: | fd96Cb / 43011 | FlyBaseID: | FBgn0004898 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997188.2 | Gene: | FOXD4 / 2298 | HGNCID: | 3805 | Length: | 439 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 76/198 - (38%) |
---|---|---|---|
Similarity: | 96/198 - (48%) | Gaps: | 56/198 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
Fly 78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
Fly 143 MAFADPARHGHV-----LANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPASTP 202
Fly 203 NEG 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd96Cb | NP_524496.1 | FH | 13..101 | CDD:214627 | 50/87 (57%) |
Alpha_kinase | 106..>194 | CDD:295997 | 16/92 (17%) | ||
FOXD4 | NP_997188.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..46 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 62..104 | 76/198 (38%) | |||
Forkhead | 104..189 | CDD:306709 | 48/84 (57%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 203..232 | 9/69 (13%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2114 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.900 |