DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXD4

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_997188.2 Gene:FOXD4 / 2298 HGNCID:3805 Length:439 Species:Homo sapiens


Alignment Length:198 Identity:76/198 - (38%)
Similarity:96/198 - (48%) Gaps:56/198 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||.|||:|..|||:.||.:.|.||.|..||.|:||:||:....||||:|||||.||||:|:||.
Human   104 KPPSSYIALITMAILQSPHKRLTLSGICAFISDRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPRE 168

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
            ..:.|||:||:|.|.:.|||:|||.|||||||:..|                             
Human   169 PGRPGKGNYWSLDPASQDMFDNGSFLRRRKRFQRHQ----------------------------- 204

  Fly   143 MAFADPARHGHV-----LANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPASTP 202
                 |....|:     |..|.||..:|       .|..:...||.|:          |.|.:.|
Human   205 -----PTPGAHLPHPFPLPAAHAALHNP-------RPGPLLGAPAPPQ----------PVPGAYP 247

  Fly   203 NEG 205
            |.|
Human   248 NTG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 50/87 (57%)
Alpha_kinase 106..>194 CDD:295997 16/92 (17%)
FOXD4NP_997188.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..104 76/198 (38%)
Forkhead 104..189 CDD:306709 48/84 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..232 9/69 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.