DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXF1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001442.2 Gene:FOXF1 / 2294 HGNCID:3809 Length:379 Species:Homo sapiens


Alignment Length:306 Identity:95/306 - (31%)
Similarity:130/306 - (42%) Gaps:72/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            :|||||||:|..|||..||.:.|.|||||:|:..:|||:|.:.|.|:||:|||||.|:||||:|:
Human    47 EKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPK 111

  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVK-QLEKDISNW------------------- 121
            .:.:.|||.|||:.|.:..|||.||..||.:.||.| |..|.:.:.                   
Human   112 GLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSA 176

  Fly   122 --------KLAAAANTEMVTHYLDDQLTQMAFAD------PARHGHVL---ANASAAQMSPY--K 167
                    .||......|:..:|...:..||...      |:..||..   ...:||...|:  .
Human   177 GGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHDS 241

  Fly   168 ATP--PILPT--------------TVTQLPARPKRAFTI-ESLMAPDPASTPNEGLVPMEYGSPD 215
            :.|  |:|||              :....|.....|... .|.:...|.|..|....|:. ||..
Human   242 SVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPLS-GSLS 305

  Fly   216 AVALEKPPFNLPFNFNELAAQYQLYFPSFFYNGQYGNIPCYQKTPP 261
            ..:||:|  .|..|.:...|:.|             .||.|....|
Human   306 THSLEQP--YLHQNSHNAPAELQ-------------GIPRYHSQSP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 49/87 (56%)
Alpha_kinase 106..>194 CDD:295997 25/143 (17%)
FOXF1NP_001442.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
FH 48..136 CDD:214627 49/87 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.