DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXG1

DIOPT Version :10

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_005240.3 Gene:FOXG1 / 2290 HGNCID:3811 Length:489 Species:Homo sapiens


Alignment Length:34 Identity:9/34 - (26%)
Similarity:19/34 - (55%) Gaps:8/34 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FHP-------SRSRKTLQNQRDLVFELALYTIPE 49
            |:|       ::|::::|..:|.|..|: ..:||
Human    26 FNPTTKSSKTNKSKRSVQETKDPVRNLS-KQLPE 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH_FOX 1..110 CDD:469596 9/34 (26%)
FOXG1NP_005240.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..181 7/29 (24%)
FH_FOXG 181..259 CDD:410795
COG5025 <184..>356 CDD:227358
Required for interaction with TLE6. /evidence=ECO:0000250|UniProtKB:Q60987 249..344
Interaction with KDM5B. /evidence=ECO:0000269|PubMed:12657635 383..406
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 427..455
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.