DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and FOXD4L1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036316.1 Gene:FOXD4L1 / 200350 HGNCID:18521 Length:408 Species:Homo sapiens


Alignment Length:277 Identity:99/277 - (35%)
Similarity:128/277 - (46%) Gaps:67/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.||.:.|.||.|..||..:||:||:....||||:|||||.||||:|:||.
Human   107 KPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPRE 171

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQL---------------EKDISNWK----L 123
            ....|||:||:|.|.:.|||:|||.|||||||:..||               ...:.|.:    |
Human   172 PGHPGKGTYWSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFPLPAAHAALHNPRPGPLL 236

  Fly   124 AAAANTEMVTHYLDDQLTQMAFAD--PAR------HGH----VLANASAAQMSPYK------ATP 170
            .|.|..:.|..         |:.:  |.|      |.|    :|.:|.|...:|.|      |||
Human   237 GAPALPQPVPG---------AYPNTAPGRRPYALLHPHPPRYLLLSAPAYAGAPKKAEGADLATP 292

  Fly   171 PILPTTVTQLPARPKR--------------AFTIESLMAPDPASTPNEGLVPMEYGSPDA---VA 218
            ..||.....|..:|..              :|:|||:|    ......|....:..||.|   ..
Human   293 GTLPVLQPSLGPQPWEEGKGLASPPGGGCISFSIESIM----QGVRGAGTGAAQSLSPTAWSYCP 353

  Fly   219 LEKPPFNLPFNFNELAA 235
            |.:.|.:|..||...||
Human   354 LLQRPSSLSDNFAATAA 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 50/87 (57%)
Alpha_kinase 106..>194 CDD:295997 32/138 (23%)
FOXD4L1NP_036316.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..104
Forkhead 107..193 CDD:278670 49/85 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.