DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxe1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_620264.1 Gene:Foxe1 / 192274 RGDID:621723 Length:370 Species:Rattus norvegicus


Alignment Length:224 Identity:96/224 - (42%)
Similarity:119/224 - (53%) Gaps:52/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSF 67
            |||:..    |||||||:|.||||.|:|:|.|.|..||:||.::|||||.|.:|||||:||||:.
  Rat    48 RPLQRG----KPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTL 108

  Fly    68 NDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMV 132
            ||||:|:||...:.|||:||.|.|.|.||||:||.|||||||:    ..|:|.:           
  Rat   109 NDCFLKIPREAGRPGKGNYWALDPNAEDMFESGSFLRRRKRFK----RSDLSTY----------- 158

  Fly   133 THYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTV-TQLPARPKRAFT--IESLM 194
                           || :.|..|.|:||      |...|.|..| ...||.|...:.  ...|.
  Rat   159 ---------------PA-YMHDAAAAAAA------AAAAIFPGAVPAARPAYPGAVYAGYAPPLA 201

  Fly   195 APD----PASTPNE----GLVPMEYGSPD 215
            ||.    ||::|..    ||||....|||
  Rat   202 APPPVYYPAASPGPCRVFGLVPERPLSPD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 55/87 (63%)
Alpha_kinase 106..>194 CDD:295997 20/90 (22%)
Foxe1NP_620264.1 FH_FOXE 54..142 CDD:410793 55/87 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.