DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and fkh-9

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001024760.1 Gene:fkh-9 / 180670 WormBaseID:WBGene00001441 Length:300 Species:Caenorhabditis elegans


Alignment Length:185 Identity:57/185 - (30%)
Similarity:83/185 - (44%) Gaps:36/185 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PLKMSYGD--QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQK--WQNSLRHN 64
            ||..:..|  ::|..||..|...||..||::.|.|:|||:.|....|:||....:  ||||:|||
 Worm    55 PLAAASSDNFERPSLSYKDLIIEAIDRSPEKRLKLNEIYQVIRLLHPYYRHRPDQWGWQNSIRHN 119

  Fly    65 LSFNDCFIKVPRNVTKAG--KGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAA 127
            ||.:|||:|:|...|.|.  .|.:||:.|...|.    ..||||.|.:.:.|.|.....:     
 Worm   120 LSLHDCFVKLPLKQTSASGVVGHFWTVVPELSDK----QTLRRRNRQQPRALAKKSDAGR----- 175

  Fly   128 NTEMVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPA 182
                 |...||:                .::.:.:.||..:.|.|.|.....:|:
 Worm   176 -----TLSRDDR----------------GSSGSGETSPSPSQPSISPPNENPMPS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 38/91 (42%)
Alpha_kinase 106..>194 CDD:295997 13/77 (17%)
fkh-9NP_001024760.1 FH 66..153 CDD:214627 37/86 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.