DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and pha-4

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001041114.1 Gene:pha-4 / 180357 WormBaseID:WBGene00004013 Length:506 Species:Caenorhabditis elegans


Alignment Length:307 Identity:106/307 - (34%)
Similarity:138/307 - (44%) Gaps:90/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFI 72
            :||..|||||||||..|||..|..|.|.|||||.:|||.||:|:.|.|:||||:||:|||||||:
 Worm   231 TYGQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFV 295

  Fly    73 KVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLD 137
            ||.|:..|.||||:||||....:|||||..|||:|||:||:.|                      
 Worm   296 KVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKERE---------------------- 338

  Fly   138 DQLTQMAFADPARHGHVLANASAAQMSPYKATPPIL-----PTTVTQ---------LPARPKRAF 188
                      |:|...   ||::.|:...:..|.:.     ||::|.         :|....:..
 Worm   339 ----------PSRKKR---NANSQQLHQQQHIPKMEIKEEDPTSITTTSSLGAYSLIPQISTKKE 390

  Fly   189 TIESLMAPD--PASTPNEGLVPMEYGSPDAVALEKP-------------------------PFNL 226
            ..|.|.|..  .|:..|.||:... |:|.||...:|                         |:..
 Worm   391 IKEELKAVQDATAAAANLGLIDPS-GTPSAVNHSQPTSVISSVGTLGTTQAQMTLNGQYASPYLY 454

  Fly   227 PFNFNELAAQYQ------LY-----FPSFFY-NGQYGNIPCYQKTPP 261
            ..:|..:..|.|      ||     :|...| ||.|.| ..|..|.|
 Worm   455 SSDFATILPQSQNFLNNTLYNTTSSYPGIDYTNGVYQN-TLYSSTNP 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 57/87 (66%)
Alpha_kinase 106..>194 CDD:295997 17/101 (17%)
pha-4NP_001041114.1 FH 236..324 CDD:214627 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.