DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and pes-1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001023406.1 Gene:pes-1 / 177267 WormBaseID:WBGene00003976 Length:264 Species:Caenorhabditis elegans


Alignment Length:181 Identity:60/181 - (33%)
Similarity:84/181 - (46%) Gaps:34/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQ--KWQNSLRHNLSFNDCFIKV 74
            ::|.|||.:|.||||..||.:.|.:||||::|...|.:| ||.:  :||||:|||||.:..|.||
 Worm    92 KRPKYSYNALIAMAIQSSPFKSLRVSEIYKYISSNFSYY-KNQKPLQWQNSVRHNLSLHKEFRKV 155

  Fly    75 PRNVTKAGKGSYWTL-HPMAFDMF--ENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYL 136
            .   |..||||||.: ..:..|::  .|...|||:|.               ..|....|..|:.
 Worm   156 R---TLDGKGSYWAMTADLGTDVYISNNCGKLRRQKS---------------KVAKFPPMQQHFP 202

  Fly   137 DDQLT-----QMAFADPARHGHVLANASAAQMSPYKATP-----PILPTTV 177
            ..||.     |:...:|.....:|.|.....|...:..|     ||:|..:
 Worm   203 IPQLPTQNIHQLCMQNPQILATLLQNMYLQNMQNLQNIPMVPGFPIIPVPI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 42/92 (46%)
Alpha_kinase 106..>194 CDD:295997 15/82 (18%)
pes-1NP_001023406.1 FH 93..168 CDD:238016 40/78 (51%)
rad23 <203..>240 CDD:273167 7/36 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.