DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and unc-130

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_496411.1 Gene:unc-130 / 174721 WormBaseID:WBGene00006853 Length:333 Species:Caenorhabditis elegans


Alignment Length:210 Identity:83/210 - (39%)
Similarity:115/210 - (54%) Gaps:33/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|.||:|::||::.|.||||..||:::|.:|::....||||:|||||.||||:||.|.
 Worm   127 KPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARG 191

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHY---LDDQ 139
            ....|||:||.|.|...|||:|||.||||||::     |:...:.       ||::|:   ....
 Worm   192 PGNPGKGNYWALDPNCEDMFDNGSFLRRRKRYK-----KNSDTYH-------EMMSHHPMPFPPF 244

  Fly   140 LTQ-MAFADPARHGHVLANAS--AAQMSPYKATPPI----LPTTVTQLPARPKRAFTIESLMAP- 196
            |.| |.|  |.|..|.:||..  ...|:| :|.|.:    :|..:.........|..|..:.|| 
 Worm   245 LPQGMPF--PPRMMHPMANIPMLGHPMNP-RAVPNMPAFFIPQNIDSQKLLSMMASRIMPMDAPV 306

  Fly   197 -------DPASTPNE 204
                   ..:|:|||
 Worm   307 SSGQKRTSSSSSPNE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 49/87 (56%)
Alpha_kinase 106..>194 CDD:295997 23/97 (24%)
unc-130NP_496411.1 COG5025 <126..330 CDD:227358 83/210 (40%)
Forkhead 127..212 CDD:365978 47/84 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.900

Return to query results.
Submit another query.