DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxk1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_951031.2 Gene:Foxk1 / 17425 MGIID:1347488 Length:719 Species:Mus musculus


Alignment Length:246 Identity:73/246 - (29%)
Similarity:97/246 - (39%) Gaps:49/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVP 75
            :.||||||..|...||..:..|.|.||.||..|...:|:||...:.||||:|||||.|..|||||
Mouse   289 ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVP 353

  Fly    76 RNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKR----FRVKQLEKDISNWKLAAAANTEMVTHYL 136
            |:..:.||||:|.:.|.:.......:..:||:|    ||..                       .
Mouse   354 RSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTP-----------------------F 395

  Fly   137 DDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPAST 201
            ....::.|.|.|...|.:...:|..|      ||..|....:.:|..|.        :....||.
Mouse   396 GPLSSRSAPASPTHPGLMSPRSSGLQ------TPECLSREGSPIPHDPD--------LGSKLASV 446

  Fly   202 PNEGLVPMEYGSP---DAVALEKPPFNLPFNFNELAAQYQLYFPSFFYNGQ 249
            |.........|||   ..|.:..||  .|.|   |.|:...|.|:.....|
Mouse   447 PEYRYSQSAPGSPVSAQPVIMAVPP--RPSN---LVAKPVAYMPASIVTSQ 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 41/87 (47%)
Alpha_kinase 106..>194 CDD:295997 15/91 (16%)
Foxk1NP_951031.2 Interaction with SIN3A and SIN3B. /evidence=ECO:0000269|PubMed:10620510, ECO:0000269|PubMed:22476904 2..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..67
Required for interaction with FOXO4 and MEF2C. /evidence=ECO:0000269|PubMed:22956541 81..406 47/139 (34%)
FHA <88..190 CDD:224630
FHA 96..189 CDD:238017
Forkhead 291..377 CDD:278670 41/85 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..443 11/57 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 665..719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.