DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and fkh-8

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001254107.1 Gene:fkh-8 / 174026 WormBaseID:WBGene00001440 Length:328 Species:Caenorhabditis elegans


Alignment Length:79 Identity:34/79 - (43%)
Similarity:46/79 - (58%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKN-TQKWQNSLRHNLSFNDCFIK 73
            |..||||||..|..:||..:|.:...|:|||.||...|.|||:| ...|:||:|||||.|..|.:
 Worm    71 GADKPPYSYSQLIRLAIEDTPDKKCTLAEIYSFIAHNFQFYRENRNSSWKNSIRHNLSLNKQFSR 135

  Fly    74 VPRNVTKAGKGSYW 87
            :.:  |...:..:|
 Worm   136 IEK--TDGDRRGWW 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 33/76 (43%)
Alpha_kinase 106..>194 CDD:295997
fkh-8NP_001254107.1 COG5025 30..>217 CDD:227358 34/79 (43%)
FH 74..156 CDD:214627 33/76 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.