Sequence 1: | NP_524496.1 | Gene: | fd96Cb / 43011 | FlyBaseID: | FBgn0004898 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032619.1 | Gene: | Foxd2 / 17301 | MGIID: | 1347471 | Length: | 492 | Species: | Mus musculus |
Alignment Length: | 246 | Identity: | 93/246 - (37%) |
---|---|---|---|
Similarity: | 117/246 - (47%) | Gaps: | 56/246 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
Fly 78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQL---------EKDISNWKLAAAANTEMVT 133
Fly 134 HYLDDQLTQMAFA-------------------------DPARHGHVLANASAA--QMS--PYKAT 169
Fly 170 PPILPTTVTQLPARPKRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALE 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd96Cb | NP_524496.1 | FH | 13..101 | CDD:214627 | 52/87 (60%) |
Alpha_kinase | 106..>194 | CDD:295997 | 26/125 (21%) | ||
Foxd2 | NP_032619.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 13..125 | ||
Forkhead | 129..215 | CDD:278670 | 51/85 (60%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 309..344 | 12/44 (27%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 394..441 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
2 | 1.960 |