DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxd2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_032619.1 Gene:Foxd2 / 17301 MGIID:1347471 Length:492 Species:Mus musculus


Alignment Length:246 Identity:93/246 - (37%)
Similarity:117/246 - (47%) Gaps:56/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.||::.|.||||..||..:||:||:....||||:|||||.||||:|:||.
Mouse   129 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 193

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQL---------EKDISNWKLAAAANTEMVT 133
            ....|||:||||.|.:.|||:|||.|||||||:.:.|         ..::.....||||.     
Mouse   194 PGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLPPPHPHPHPHPELLLRGGAAAAG----- 253

  Fly   134 HYLDDQLTQMAFA-------------------------DPARHGHVLANASAA--QMS--PYKAT 169
               |......:||                         .|..|.|..|.|:.|  |:|  |.:|.
Mouse   254 ---DPGAFLSSFAAYGAYGYGYGLALPAYGAPPPGPAPHPHPHPHAFAFAATAPCQLSVPPGRAA 315

  Fly   170 PPILPTTVTQLPARPKRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALE 220
            .|  |      |..|..:....:..||.||..|..|  |...|.|..:..|
Mouse   316 AP--P------PGPPTASVFASAASAPAPAPAPGSG--PSPAGLPAFLGAE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 52/87 (60%)
Alpha_kinase 106..>194 CDD:295997 26/125 (21%)
Foxd2NP_032619.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..125
Forkhead 129..215 CDD:278670 51/85 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..344 12/44 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 394..441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.