DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxe3

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_599166.1 Gene:Foxe3 / 171302 RGDID:621727 Length:286 Species:Rattus norvegicus


Alignment Length:237 Identity:89/237 - (37%)
Similarity:111/237 - (46%) Gaps:69/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSF 67
            |||:..    |||||||:|.|||:.|:|.|.|.|:.|||||.::|.|||.:.:|||||:||||:.
  Rat    58 RPLQRG----KPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTL 118

  Fly    68 NDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMV 132
            ||||:||||.....|||:||||.|.|.|||:|||.|||||||:..:|.                 
  Rat   119 NDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRTELP----------------- 166

  Fly   133 THYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESL---- 193
                                     |......||...||    .....||.|.|.|.::||    
  Rat   167 -------------------------APPPPPFPYAPFPP----APAPAPAPPARLFRLDSLLGLQ 202

  Fly   194 ------MAPDP--ASTPNEGLVPMEYGSPDAVALEKPPFNLP 227
                  :||:|  .:.|:...       |...|...||...|
  Rat   203 TEPPGPLAPEPPCCAAPDASF-------PPCAAAASPPLYSP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 55/87 (63%)
Alpha_kinase 106..>194 CDD:295997 17/97 (18%)
Foxe3NP_599166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 3/3 (100%)
FH 64..152 CDD:214627 55/87 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.