DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxl1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_032050.2 Gene:Foxl1 / 14241 MGIID:1347469 Length:336 Species:Mus musculus


Alignment Length:282 Identity:102/282 - (36%)
Similarity:133/282 - (47%) Gaps:56/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            ||||||||:|.||||..:|::.:.|:.||:||||:||||..|.|.||||:|||||.|:||:||||
Mouse    48 QKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKVPR 112

  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRR------------KRFRVKQLEK----DISNWKLAA 125
            ...:.||||||||.|...||||||:..||:            ||.||:..|.    |:.:..||.
Mouse   113 EKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAGSPEAKRTRVEPPESEVGCDVGSPDLAT 177

  Fly   126 AANTEMVTHYLDDQLTQMAFADPAR-----------------HGHVLANASAAQMSPYKATPPIL 173
            |..|.....   .|...:..|.||.                 .|.....:...|...:....|:.
Mouse   178 ALPTRAPDR---SQSPAVGTARPALLPWPGPEPRDPDADLTVQGAGAVASGQLQRPAHHLGSPLC 239

  Fly   174 PTTVTQLPARPKRAFTIESLMAPDPASTPNEGL--------VPMEYGSPDAVALE--KPPFN--L 226
            |...........::|:|:|::|..|  ||..|.        ||...||....|..  .||||  |
Mouse   240 PAPSGSPKGSKSKSFSIDSILAVRP--TPASGAEAPGIPKPVPGALGSSLLAASSGLAPPFNASL 302

  Fly   227 PFN------FNELAAQYQLYFP 242
            .|:      |::|...:..|||
Mouse   303 VFDAHVQGGFSQLGIPFLSYFP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 56/87 (64%)
Alpha_kinase 106..>194 CDD:295997 21/120 (18%)
Foxl1NP_032050.2 FH 49..137 CDD:214627 56/87 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..214 16/76 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..252 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.