DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxb2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_032049.1 Gene:Foxb2 / 14240 MGIID:1347468 Length:428 Species:Mus musculus


Alignment Length:240 Identity:106/240 - (44%)
Similarity:131/240 - (54%) Gaps:26/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNL 65
            ||||.|.||.||||||||||||||||.||.:::||||:||:|||::||:||::||:|||||||||
Mouse     1 MPRPGKSSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNL 65

  Fly    66 SFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRV-----KQLEKDISNWKLAA 125
            ||||||||:||...:.||||:|.|||...|||||||.|||||||:|     ..|....|......
Mouse    66 SFNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFKVLRADHAHLHSGSSKGAPGT 130

  Fly   126 AANTEMVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTI 190
            .....:..|:       ...|....|.|..|........|.:..||..|..|.....:|      
Mouse   131 GPGGHLHPHH-------PHHAHHHHHHHHHAAHHHHHHHPPQPPPPPPPHMVPYFHQQP------ 182

  Fly   191 ESLMAPDPASTPNEGLVPMEYGSPDAVALEKPPFNLPFNFNELAA 235
              ..||.|...|::   |.:...|.:   :.|..:.|....|.||
Mouse   183 --APAPQPPHLPSQ---PAQQPQPQS---QPPQTSHPGKMQEAAA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 63/87 (72%)
Alpha_kinase 106..>194 CDD:295997 18/92 (20%)
Foxb2NP_032049.1 FH 13..101 CDD:214627 63/87 (72%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..217 21/119 (18%)
E_Pc_C <342..>406 CDD:284226
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 408..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG3562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1236900at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - mtm8816
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.