Sequence 1: | NP_524496.1 | Gene: | fd96Cb / 43011 | FlyBaseID: | FBgn0004898 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034355.2 | Gene: | Foxf2 / 14238 | MGIID: | 1347479 | Length: | 446 | Species: | Mus musculus |
Alignment Length: | 274 | Identity: | 88/274 - (32%) |
---|---|---|---|
Similarity: | 123/274 - (44%) | Gaps: | 71/274 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
Fly 77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVK------QLEKDISNWKLAAAANTEMVTHY 135
Fly 136 LDDQ-----------------LTQM-------AFADPARHGHVLANASAAQMSP-----YKATPP 171
Fly 172 ILP----------------------TTVTQLPARPKRAFTIESLMAPDPASTPNEGLVPMEYGSP 214
Fly 215 DAVA-LEKPPFNLP 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd96Cb | NP_524496.1 | FH | 13..101 | CDD:214627 | 49/87 (56%) |
Alpha_kinase | 106..>194 | CDD:295997 | 26/144 (18%) | ||
Foxf2 | NP_034355.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..97 | ||
FH | 100..188 | CDD:214627 | 49/87 (56%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 257..278 | 6/20 (30%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 304..325 | 2/20 (10%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 340..371 | 7/20 (35%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |