DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxf2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_034355.2 Gene:Foxf2 / 14238 MGIID:1347479 Length:446 Species:Mus musculus


Alignment Length:274 Identity:88/274 - (32%)
Similarity:123/274 - (44%) Gaps:71/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            :|||||||:|..|||..||.:.|.|||||:|:..:|||:|...|.|:||:|||||.|:||||:|:
Mouse    99 EKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPK 163

  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVK------QLEKDISNWKLAAAANTEMVTHY 135
            .:.:.|||.|||:.|.:..|||.||..||.:.||.|      ...:.:|.....|:    ::...
Mouse   164 GLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYHRVVSGLGFGAS----LLPQG 224

  Fly   136 LDDQ-----------------LTQM-------AFADPARHGHVLANASAAQMSP-----YKATPP 171
            .|.|                 |..|       |.|....|.|.|.:.....|||     |.|:.|
Mouse   225 FDFQAPPSAPLGCHGQGGYGGLDMMPAGYDTGAGAPGHAHPHHLHHHHVPHMSPNPGSTYMASCP 289

  Fly   172 ILP----------------------TTVTQLPARPKRAFTIESLMAPDPASTPNEGLVPMEYGSP 214
            : |                      ::.:.:|:.|..|..||   ...|.::|     ...:.||
Mouse   290 V-PAGPAGVGAAAGGGGGGGDYGPDSSSSPVPSSPAMASAIE---CHSPYTSP-----AAHWSSP 345

  Fly   215 DAVA-LEKPPFNLP 227
            .|.. |::||...|
Mouse   346 GASPYLKQPPALTP 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 49/87 (56%)
Alpha_kinase 106..>194 CDD:295997 26/144 (18%)
Foxf2NP_034355.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97
FH 100..188 CDD:214627 49/87 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..278 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..325 2/20 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..371 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.