DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and Foxj1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_446284.2 Gene:Foxj1 / 116557 RGDID:621764 Length:421 Species:Rattus norvegicus


Alignment Length:317 Identity:85/317 - (26%)
Similarity:120/317 - (37%) Gaps:72/317 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPLKMSYGDQ---KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRH 63
            |.|..:.|...   ||||||.:|..||:..|....:.||.||::|.|.|.::|.....||||:||
  Rat   107 PPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRH 171

  Fly    64 NLSFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRR-------KRF-RVKQLEKDISN 120
            |||.|.|||||||...:.|||.:|.:.|...:...:|:..:||       ..| |....|...:.
  Rat   172 NLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSTAP 236

  Fly   121 WKLAAAANTEMVTHYLDDQLTQMAFAD----------PARHGH--------------------VL 155
            |......|.|.      .||.| .|.:          ..|.||                    :|
  Rat   237 WGGPLTVNREA------QQLLQ-EFEEATGEGGWGTGEGRLGHKRKQPLPKRVAKVLRPPSTLLL 294

  Fly   156 ANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPDPASTPNEGLV-----------PM 209
            ......::.|.|..  .....:.:..|..:...::|.|....|.|..:.|.|           |.
  Rat   295 TQEEQGELEPLKGN--FDWEAIFEAGALGEELSSLEGLELSPPLSPSSHGEVDLTVHGRHINCPA 357

  Fly   210 EYGSPDAVALEKPPFNLPFNFNELAAQYQLYFPSFFYNGQYGNIPCYQKTPPLFHNG 266
            .:|.|    :|:...:|.|:...||..: |..|  :.....|.:|    ..|||..|
  Rat   358 TWGPP----VEQATDSLDFDETFLATSF-LQHP--WDESSSGCLP----PEPLFEAG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 40/87 (46%)
Alpha_kinase 106..>194 CDD:295997 19/125 (15%)
Foxj1NP_446284.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 1/2 (50%)
FH_FOXJ1 121..199 CDD:410797 39/77 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..277 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.