Sequence 1: | NP_524496.1 | Gene: | fd96Cb / 43011 | FlyBaseID: | FBgn0004898 | Length: | 271 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001230273.1 | Gene: | foxq1a / 100537750 | ZFINID: | ZDB-GENE-070424-74 | Length: | 312 | Species: | Danio rerio |
Alignment Length: | 258 | Identity: | 82/258 - (31%) |
---|---|---|---|
Similarity: | 113/258 - (43%) | Gaps: | 80/258 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 PRPLKMSYGD-----QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSL 61
Fly 62 RHNLSFNDCFIKVPRNVTKA-GKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAA 125
Fly 126 AANTEMVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAFTI 190
Fly 191 ESLMA------PDPASTPN------EGLVP----MEYGSPDAVALEKP----------PFNLP 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd96Cb | NP_524496.1 | FH | 13..101 | CDD:214627 | 44/88 (50%) |
Alpha_kinase | 106..>194 | CDD:295997 | 20/87 (23%) | ||
foxq1a | NP_001230273.1 | FH | 88..177 | CDD:214627 | 44/88 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |