DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxd2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_002931458.1 Gene:foxd2 / 100495241 XenbaseID:XB-GENE-479818 Length:348 Species:Xenopus tropicalis


Alignment Length:282 Identity:98/282 - (34%)
Similarity:137/282 - (48%) Gaps:78/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.||::.|.||||..||.::||:||:....||||:|||||.||||:|:||.
 Frog    78 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 142

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQ---LEKDISNWKLAA-------------- 125
            ....|||:||||.|.:.|||:|||.|||||||:.:|   :.:|.|::..||              
 Frog   143 PGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQSNEILRDPSSFMPAAFGYGPYGYNYGLQL 207

  Fly   126 ----------AANTEMVTH-----------------YLDDQLTQMAFADPARHGHVLANASAAQM 163
                      |..:...||                 :|.::||:.:|              .:|:
 Frog   208 QNYHQHHHTGATFSFQPTHCPLPPPASVFSSPTLSPFLGNELTRKSF--------------YSQL 258

  Fly   164 SPYKATPPILPTTVTQLPARPKRAFTIESLM-----APDPAS--TPNEGLVPMEYGSPDAVALEK 221
            ||   |.|||.|......:||  :|:|::::     .|.|.|  |...|      ..|..:|:..
 Frog   259 SP---TLPILQTLKPDGQSRP--SFSIDNIIGGSGSTPSPTSPYTVQPG------NQPPVIAMLS 312

  Fly   222 PPFNLPFNFNELAAQYQLYFPS 243
            |.. .|.. |.|...::...||
 Frog   313 PSL-APMQ-NHLNLSHENLLPS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 52/87 (60%)
Alpha_kinase 106..>194 CDD:295997 28/131 (21%)
foxd2XP_002931458.1 Forkhead 78..163 CDD:365978 50/84 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.