DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxl3-ot1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_002932017.1 Gene:foxl3-ot1 / 100488925 XenbaseID:XB-GENE-6035521 Length:246 Species:Xenopus tropicalis


Alignment Length:203 Identity:74/203 - (36%)
Similarity:105/203 - (51%) Gaps:35/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            :|.||||:|.||||..||...:.||.||.|||.:||:||.|.:.||||:|||||.|.||:||||.
 Frog    32 RPAYSYIALIAMAIQQSPDSKVTLSGIYDFIMKKFPYYRSNQRAWQNSIRHNLSLNSCFVKVPRT 96

  Fly    78 V-TKAGKGSYWTLH---PMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDD 138
            . .:.|||:||:..   ....|:||||:..|||:|..:|:.:||....:..|....|        
 Frog    97 EGNEKGKGNYWSFASGCESMLDLFENGNYKRRRRRRNMKKCQKDRKQNQAQALHPGE-------- 153

  Fly   139 QLTQMAFADPARHGHVL------ANASAAQMSPYKATPPILP------TTVTQLPARPKRAFTIE 191
                  |:..:...||:      ..:::.||.    |..:.|      .|.:.|....:..|:|:
 Frog   154 ------FSTSSSTAHVIYGNEKRTESTSRQME----TDSLYPISNRQSQTSSSLGKSDEIKFSID 208

  Fly   192 SLM-APDP 198
            .:: ||||
 Frog   209 YILSAPDP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 49/91 (54%)
Alpha_kinase 106..>194 CDD:295997 18/99 (18%)
foxl3-ot1XP_002932017.1 Forkhead 32..118 CDD:365978 45/85 (53%)
COG5025 33..>224 CDD:227358 74/202 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.