DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxd4l1.2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_002935635.1 Gene:foxd4l1.2 / 100485983 XenbaseID:XB-GENE-876578 Length:338 Species:Xenopus tropicalis


Alignment Length:248 Identity:90/248 - (36%)
Similarity:117/248 - (47%) Gaps:52/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDC 70
            |.|....|||||||:|..|||:.||.|.|.||.|..||..:||:|:.....||||:|||||.|||
 Frog    90 KASRAFLKPPYSYIALITMAIVQSPYRKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDC 154

  Fly    71 FIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFR--VKQLEKD---ISNWKLAAAANTE 130
            |||:||.....|||:||||.|.:.|||:|||.|||||||:  .::|.||   :.|          
 Frog   155 FIKIPREPGNPGKGNYWTLDPASKDMFDNGSFLRRRKRFKRHHQELIKDGFLMYN---------- 209

  Fly   131 MVTHYL------DDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQL--------- 180
             ..||:      ..|...:..|.|..    ||..:.....|:|...|.....|.::         
 Frog   210 -PLHYITPYSAPQTQTPVICMAIPQN----LAMPNHLAPYPHKIKVPCPDQGVNRVFKAQDNHHT 269

  Fly   181 PARPKRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALEKPPFNLPFNFNEL 233
            .:..|.:|:||::|                 |.|.........||..:|:|.|
 Frog   270 ASHHKCSFSIENIM-----------------GEPKEPEKSLKSFNQNWNYNHL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 52/87 (60%)
Alpha_kinase 106..>194 CDD:295997 23/107 (21%)
foxd4l1.2XP_002935635.1 Forkhead 97..182 CDD:365978 50/84 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.