DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxk2

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001135634.1 Gene:foxk2 / 100216193 XenbaseID:XB-GENE-483520 Length:645 Species:Xenopus tropicalis


Alignment Length:226 Identity:68/226 - (30%)
Similarity:97/226 - (42%) Gaps:46/226 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVP 75
            |.||||||..|...||..:|.:.|.|:.||..|...:|:||...:.||||:|||||.|..|||||
 Frog   217 DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVP 281

  Fly    76 RNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKR----FRVKQLEKDISNWKLAAAANTEMVTHYL 136
            |:..:.||||:|.:.|.:.......:..:||.|    ||..                       |
 Frog   282 RSQEEPGKGSFWRIDPASESKLVEQAFRKRRPRGVPCFRTP-----------------------L 323

  Fly   137 DDQLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLP-------ARPKRAFTIESLM 194
            ....::.|.|.|...|.:.|::|..|      ||..|....:.:|       .:||.|...|:..
 Frog   324 GPLSSRSAPASPNHAGVLSAHSSGLQ------TPESLSREGSPIPMEPEPSAIQPKLAVIQEARF 382

  Fly   195 APDPASTP---NEGLVPMEYGSPDAVALEKP 222
            |.....:|   .:.|:.::...|..:   ||
 Frog   383 AQSAPGSPLSSQQVLIAVQRQLPQTI---KP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 40/87 (46%)
Alpha_kinase 106..>194 CDD:295997 20/98 (20%)
foxk2NP_001135634.1 FHA 10..117 CDD:238017
Forkhead 218..304 CDD:365978 40/85 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.