DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxc1a

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_571803.1 Gene:foxc1a / 100148408 ZFINID:ZDB-GENE-010302-1 Length:476 Species:Danio rerio


Alignment Length:242 Identity:94/242 - (38%)
Similarity:127/242 - (52%) Gaps:49/242 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPLKM---------------SYGDQ----------KPPYSYISLTAMAIIHSPQRLLPLSEIY 40
            ||.|:.|               :||..          |||||||:|..|||.:||.:.:.|:.||
Zfish    37 MPAPMTMYSHAAHDQYPASMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNSPDKKVTLNGIY 101

  Fly    41 RFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRR 105
            :|||::|||||.|.|.||||:|||||.|:||:||||:..|.||||||||.|.:::||||||.|||
Zfish   102 QFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRR 166

  Fly   106 RKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATP 170
            |:||:.|...||..: :....|.:........:|...:..:.|.|...:......:  :|.:|..
Zfish   167 RRRFKKKDAMKDKED-RGVKEAPSRQAQPQAREQEQSVPGSQPVRIQDIKTENGTS--TPPQAVS 228

  Fly   171 PILPTTVTQLPARPKRAFTIESLMAPDPASTPNEGLVPMEYGSPDAV 217
            |.|.|.       ||    |||   ||.:|:       |..|||.::
Zfish   229 PTLSTV-------PK----IES---PDSSSS-------MSSGSPHSI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 56/87 (64%)
Alpha_kinase 106..>194 CDD:295997 20/87 (23%)
foxc1aNP_571803.1 Forkhead 74..160 CDD:278670 54/85 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..271 26/110 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.