DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxg1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001116933.1 Gene:foxg1 / 100144706 XenbaseID:XB-GENE-480076 Length:432 Species:Xenopus tropicalis


Alignment Length:260 Identity:87/260 - (33%)
Similarity:115/260 - (44%) Gaps:49/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            :|||:||.:|..|||..||::.|.|:.||.|||..||:||:|.|.||||:|||||.|.||:||||
 Frog   123 EKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPR 187

  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLT 141
            :....|||:||.|.|.:.|:|..|:..:.|:|       ...|..|||......:.:       |
 Frog   188 HYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRR-------STTSRAKLAFKRGARLTS-------T 238

  Fly   142 QMAFADPARHGHV---------LANASAAQMSPYKATPPILPTTVTQLPARPKRAFTIESLMAPD 197
            .:.|.|  |.|.:         |.:..|:....|..|....|:.    |.......|..||.:..
 Frog   239 GLTFMD--RAGSLYWPMSPFLSLHHPRASSALSYNGTTSAYPSH----PMPYSSVLTQNSLGSNH 297

  Fly   198 PASTPN--------EGLVPMEYGSPDAVAL-EKPPFNLPF-----------NFNELAAQYQLYFP 242
            ..||.|        .|.:|.......|.|| ...|..||.           :.|.||.|...:||
 Frog   298 SFSTSNGLSVDRLVNGEIPYATHHLTAAALAASVPCGLPVPCSGTYSLNPCSVNLLAGQTGYFFP 362

  Fly   243  242
             Frog   363  362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 49/87 (56%)
Alpha_kinase 106..>194 CDD:295997 19/96 (20%)
foxg1NP_001116933.1 FH 124..212 CDD:214627 49/87 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.